Ad unit: TOOLZ Home Top

IP/Domain name tracking information

Domain Name:

afspraakjes.nl

    check status or 
    track blog visitors with Mobile Tracker
Domain IP Address:
149.210.198.135
Page Text Response:
154.21 (ms)
Website Ranking:
Alexa838,152
SEO Report Time:
Created: 16 hours, 40 min ago, Updated: 16 hours, 40 min ago
Meta Tags:
Title Afspraakjes.com - Gratis erotische datingsite voor swingers met een overzicht van alle escort en prive dames, heren en koppels uit Belgie en Nederland
150 characters
(SEO title should be 50-70 long)
Description Gratis datingsite voor swingers met een overzicht van alle escort en prive dames, heren en koppels uit Belgie en Nederland. Ook live webcams, parenclubs, sexcinema's, prive sauna's, rendez-vous hotels, bars / sexclubs en erotische agenda
237 characters
(SEO description should be 40-160 long)
Keywords escort, prive, seksdating, sexdating, prive sauna, rendez-vous hotel, parenclubs, escort antwerpen, escort brussel, escort gent, sexcinema, sekscinema, seksspeeltjes, sexspeeltjes, prive ontvangst, sexcam, sexcams, Webcammen, webcamsex, seks dating, escort brugge, escort hasselt
279 characters
Robots index,follow
Internet service provider:
Transip B.V.
Organization:
Transip B.V.
Country name:
Netherlands
Country ISO alpha-2 code:
NL
State:
South Holland
City:
Leiden
Timezone:
Europe/Amsterdam
Longitude:
4.4961
Latitude:
52.167
WHOIS last updated:
new WHOIS data is currently unavailable for all requests [GL3000-3000]. Try again in 54 min, 38 sec.
Forward DNS primary host:
149.210.198.135
Forward DNS expanded data:
afspraakjes.nl has address 149.210.198.135
Forward DNS last updated:
16 hours, 40 min ago on August 14, 2018, 6:24 am GMT Time
Forward DNS next check:
in 5 months, 28 days on August 14, 2018, 6:24 am GMT Time
Reverse DNS host:
afspraakjes.com
Reverse DNS pointer:
afspraakjes.com
Reverse DNS in-addr.arpa:
135.198.210.149.in-addr.arpa domain name pointer hosted-by.afspraakjes.com.
Reverse DNS last updated:
0 seconds ago on August 14, 2018, 11:05 pm GMT Time
Reverse DNS next check:
in 5 months, 29 days on August 14, 2018, 11:05 pm GMT Time
Website Headers:
Response 200 OK
Age Content-Langu nl
Cache-control private,no-cache
Content-encoding gzip
Content-type text/html
Content_length 3600
Content-language nl
Date Tue, 14 Aug 2018 05:21:37 GMT
Expires Sun, 12 Aug 2018 05:21:36 GMT
Location http://www.afspraakjes.nl/index.asp
Pragma no-cache
Server Microsoft-IIS/7.5
Set-cookie ASPSESSIONIDQCBADDDB=OIMKONBBCMKBGCCLDFHIEGPD; path=/ASPSESSIONIDQCBADDDB=GJMKONBBFGFHBNLCPCMKFKJC; path=/
Vary Accept-Encoding
X-powered-by ASP.NET
Record views
8816

domain name tracking data

This domain tracing stats is software compiled exclusively for afspraakjes.nl.

website RESPONSE STATUS

The domain ID has responded to connection request with a HTTP/HTTPS server response code 200. Afspraakjes.nl web site replied with content in 154.21 (ms).

web-pagesocial propagation

This website social differentiation is as follows: Alexa rank: 838152.

webpage keywords analysis

The total number of words analyzed within the text of afspraakjes.nl is 196.Alexa rank: 838152. The most important word within text body of afspraakjes.nl is defined as En. The keyword En is utilized 10 times. The second most utilized key string used is confirmed to be the Een and is employed 4 times. Other principal word(s) are alle, en, een, alle, met, afspraakjes, sauna's, voor, afspraakjes.com, dan, overzicht, van, escort, datingsite, heren, swingers, sexcinema's, het, gezocht-te, www, sexdating.

This most used 2-word keyword combo in body text of afspraakjes.nl is Overzicht van. The key string Overzicht van is in use 3 times. The second most frequently placed two-word word combination put to use is determined to be the Rendez-vous hotels and is utilized 2 times. Other prominent dual-word keyword(s) are parenclubs rendez-vous, overzicht van, rendez-vous hotels, parenclubs rendez-vous, dames heren, erotische datingsite, per dag, erotheken sexshops, hotels privé, escort en, en nederland, bars sexclubs, sauna's sexcinema's, privé sauna's.

Internet Protocol Address INFO

The IP (Internet protocol) tracking statistics is machine collected particularly for 149.210.198.135. This host has the IP (hardware Internet protocol) 149.210.198.135.The IP (a.k.a. conforms to valid specifications of an IPv4 Internet protocol), which has an un-compressed value of 149.210.198.135.

The reverse DNS for the checked host is afspraakjes.com. A domain host pointer is tracked as afspraakjes.com.A full reply for the inspected reverse DNS query was captured as afspraakjes.com at the time of this request.

ORGANIZATION AND ISP

An organization that is associated with serving the content for afspraakjes.nl is Transip B.V..An Internet Service Provider (also known as ISP) that digitally servers the content for this hardware afspraakjes.nl is Transip B.V..

IP physical location

The data for the tracing evidence implies that the connection to this host has an assigned physical location address in Leiden, South Holland, Netherlands.The timezone of the origination point of this host is Europe/Amsterdam.

COPY & PASTE html code for afspraakjes.nl report
To link to afspraakjes.nl report from your website or blog, copy and paste this html code into your web page
Direct URL for afspraakjes.nl report
This simple url can be used for refering to afspraakjes.nl report in emails and printed media

Keyword Density

Word count: 196
All keywords (41)CountKeyword density
en 10 5.10 %
een 4 2.04 %
alle 3 1.53 %
met 3 1.53 %
afspraakjes 3 1.53 %
sauna's 3 1.53 %
voor 3 1.53 %
afspraakjes.com 3 1.53 %
dan 3 1.53 %
overzicht 3 1.53 %
van 3 1.53 %
escort 3 1.53 %
datingsite 2 1.02 %
heren 2 1.02 %
swingers 2 1.02 %
sexcinema's 2 1.02 %
het 2 1.02 %
gezocht-te 2 1.02 %
www 2 1.02 %
sexdating 2 1.02 %
nederland 2 1.02 %
erotisch 2 1.02 %
erotische 2 1.02 %
gratis 2 1.02 %
prive 2 1.02 %
koppels 2 1.02 %
dames 2 1.02 %
parenclubs 2 1.02 %
bars 2 1.02 %
hotels 2 1.02 %
rendez-vous 2 1.02 %
help 2 1.02 %
laatste 2 1.02 %
sexshops 2 1.02 %
privé 2 1.02 %
per 2 1.02 %
dag 2 1.02 %
de 2 1.02 %
meer 2 1.02 %
erotheken 2 1.02 %
sexclubs 2 1.02 %
Two-keyword phrases (13)CountKeyword density
overzicht van 3 1.54 %
rendez-vous hotels 2 1.03 %
parenclubs rendez-vous 2 1.03 %
dames heren 2 1.03 %
erotische datingsite 2 1.03 %
per dag 2 1.03 %
erotheken sexshops 2 1.03 %
hotels privé 2 1.03 %
escort en 2 1.03 %
en nederland 2 1.03 %
bars sexclubs 2 1.03 %
sauna's sexcinema's 2 1.03 %
privé sauna's 2 1.03 %
Three-keyword phrases (4)CountKeyword density
parenclubs rendez-vous hotels 2 1.03 %
rendez-vous hotels privé 2 1.03 %
privé sauna's sexcinema's 2 1.03 %
hotels privé sauna's 2 1.03 %
Four-keyword phrases (3)CountKeyword density
parenclubs rendez-vous hotels privé 2 1.04 %
hotels privé sauna's sexcinema's 2 1.04 %
rendez-vous hotels privé sauna's 2 1.04 %
Website Visitors are NOT statistics

Recent [80] domain whois and domain IP address DNS queries as of August 14, 2018, 11:05 pm [GMT]. Next update in 29 min, 41 sec

ID IP Address Domain Name Domain IP Reverse Dns ISP Country City / State
1 212.147.77.206 cttpeseux.ch kore.tizoo.com VTX Services SA Switzerland Delémont, Jura
2 208.91.197.20 kiriko.com - - - Confluence Networks British Virgin Islands - - -
3 208.113.171.120 red-ring.com apache2-grog.bartow.dreamhost.com New Dream Network, LLC United States Brea, California
4 208.91.197.26 conquer.com - - - Confluence Networks British Virgin Islands Road Town, Washington
5 62.149.142.69 giovaniconnection.it webx303.aruba.it Aruba S.p.A. Italy Arezzo, Tuscany
6 67.195.197.76 pcmagtest.us p11ats-i.geo.vip.bf1.yahoo.com Yahoo! United States Santa Clara, California
7 72.232.181.99 automaniabrandon.com nexus-links.com DataPipe United States Jersey City, New Jersey
8 46.4.10.45 article.techlabs.kz mail.gsstudio.tv Hetzner Online GmbH Germany - - -
9 5.144.133.146 hychuseknung.mihanblog.com 5-144-133-146.static.hostiran.name Noavaran Shabakeh Sabz Mehregan Company Limited Iran Mehregan, Isfahan
10 81.20.200.182 mygorod48.gzt.ru - - - LLC Promsvyaz-Invest Russian Federation Lipetsk, Lipetskaya Oblast'
11 208.91.197.26 givemebooks.com - - - Confluence Networks British Virgin Islands Road Town, Washington
12 208.91.197.25 clearapplications.com - - - Confluence Networks British Virgin Islands Road Town, Xinjiang Uygur Zizhiqu
13 89.253.229.80 historymed.ru ds-1030910-8141.host4g.ru Rusonyx, Ltd. Russian Federation - - -
14 162.144.23.157 onefamilyinc.org 162-144-23-157.unifiedlayer.com Unified Layer United States Provo, Utah
15 178.237.38.17 amateurpin.com - - - Schuberg Philis B.V. Netherlands - - -
16 208.91.197.27 bahamasny.com - - - Confluence Networks United States Jacksonville, Florida
17 182.92.74.8 roddypy.com - - - Hangzhou Alibaba Advertising Co.,Ltd. China Hangzhou, Zhejiang
18 2607:f8b0:4008:812::2003 google.nl mia09s19-in-x03.1e100.net Google United States - - -
19 149.56.190.145 aden777.net ip145.ip-149-56-190.net OVH Hosting Canada Montreal, Quebec
20 2a02:fe80:1010::14:3 torklift.com - - - Sucuri United Kingdom - - -
21 208.91.197.26 adultamerica.net - - - Confluence Networks British Virgin Islands Road Town, Washington
22 46.4.10.48 article.techlabs.by techlabs.by Hetzner Online GmbH Germany - - -
23 202.233.2.4 plaza.harmonix.ne.jp plaza.harmonix.ne.jp Uniadex Japan Tokyo, Tokyo
24 58.227.193.198 netseoul.net - - - SK Broadband - - - Daegu, Daegu
25 208.91.197.25 corfitsen.com - - - Confluence Networks British Virgin Islands Road Town, Xinjiang Uygur Zizhiqu
26 62.149.128.151 studioconsani.net mxd6.aruba.it Aruba S.p.A. Italy Arezzo, Tuscany
27 61.139.126.33 jhlink.com - - - China Telecom Sichuan China Chengdu, Sichuan
28 104.27.191.15 d21b.com - - - CloudFlare United States San Francisco, California
29 62.152.62.42 redwhite.ru redwhite.ru Filanco, ltd. Russian Federation Odintsovo, Moscow Oblast
30 46.51.247.163 summonsboard.gamerch.com ec2-46-51-247-163.ap-northeast-1.compute.amazonaws.com Amazon Data Services Ireland Ltd Japan Tokyo, Tokyo
31 49.156.197.203 gp777.net 49-156-197-203.ppp.bbiq.jp QTNet Japan Fukuoka, Fukuoka
32 208.91.196.152 ucmentor.com - - - Confluence Networks British Virgin Islands - - -
33 208.91.197.130 68comebackspecial.org - - - Confluence Networks British Virgin Islands - - -
34 208.91.197.20 abacomanagement.com - - - Confluence Networks British Virgin Islands - - -
35 2804:294:4000:0:186:192:81:2 api.futebol.globosat.tv - - - Globo Comunicação e Participaçoes SA Brazil - - -
36 92.62.135.6 ironx.lt kedras.balt.net UAB Baltnetos komunikacijos - - - Vilnius, Vilnius
37 47.104.0.178 longhupaimai.com - - - Aliyun Computing Co. China Hangzhou, Zhejiang
38 109.104.81.75 limelightinteractive.net wvps109-104-81-75.vps.webfusion.co.uk Host Europe GmbH United Kingdom - - -
39 188.165.180.169 my.globoxhost.com - - - OVH SAS France - - -
40 144.76.78.189 rialconverter.com mailserver35.mylittledatacenter.com Hetzner Germany - - -
41 185.156.193.41 studionovasiri.com client.dataroute.it dataroute srl Italy Policoro, Basilicate
42 208.91.196.105 maxonusa.com - - - Confluence Networks British Virgin Islands - - -
43 153.120.61.195 f001.sublimestore.jp - - - SAKURA Internet Japan Yokohama, Kanagawa
44 23.88.208.141 hghenergizer.website ofica.webupper.net Enzu United States Los Angeles, California
45 208.91.197.127 stayvertical.com - - - Confluence Networks British Virgin Islands - - -
46 208.91.197.24 cinchboots.net - - - Confluence Networks British Virgin Islands Road Town, Washington
47 92.53.114.123 klr650.ru pulcher.timeweb.ru TimeWeb Ltd. Russian Federation St Petersburg, St.-Petersburg
48 5.144.133.146 kungaqosekab.mihanblog.com 5-144-133-146.static.hostiran.name Noavaran Shabakeh Sabz Mehregan Company Limited Iran Mehregan, Isfahan
49 113.10.171.30 bbs.cgujian.com - - - New World Telecom Ltd., Hong Kong Hong Kong Central, Central and Western District
50 208.91.197.27 lenderprise.biz - - - Confluence Networks United States Jacksonville, Florida
51 213.186.33.87 maximemacron.fr cluster014.ovh.net OVH SAS France Saran, Centre-Val de Loire
52 208.91.197.26 readoc.com - - - Confluence Networks British Virgin Islands Road Town, Washington
53 104.20.0.109 skillshare.com - - - CloudFlare United States San Francisco, California
54 104.20.23.246 shapeways.com - - - CloudFlare United States San Francisco, California
55 208.91.197.26 coldsaws.com - - - Confluence Networks British Virgin Islands Road Town, Washington
56 107.180.48.249 bapublicidad.com ip-107-180-48-249.ip.secureserver.net GoDaddy.com, LLC United States Scottsdale, Arizona
57 208.91.197.27 www1.cityofrsm.org - - - Confluence Networks United States Jacksonville, Florida
58 208.91.197.23 richboyd.com - - - Confluence Networks British Virgin Islands - - -
59 66.171.240.39 arc.interush.net www2.ihealthscience.com Alchemy Communications United States Los Angeles, California
60 109.236.82.214 maultalk.com customer.worldstream.nl WorldStream B.V. Netherlands - - -
61 103.84.194.113 tv.mypangandaran.com - - - PT. Drupadi Prima Indonesia Jakarta, Jakarta
62 50.62.160.109 bytesandtags.com p3nwvpweb066.shr.prod.phx3.secureserver.net GoDaddy.com, LLC United States Scottsdale, Arizona
63 208.91.197.25 globaldynamics.biz - - - Confluence Networks British Virgin Islands Road Town, Xinjiang Uygur Zizhiqu
64 208.91.197.128 reptv.com - - - Confluence Networks British Virgin Islands Road Town, Washington
65 159.69.54.154 driving-test-questions.com - - - Hetzner Online GmbH Germany - - -
66 204.11.56.46 hockeystop.net - - - Confluence Networks British Virgin Islands - - -
67 49.129.255.103 www2u.biglobe.ne.jp - - - Biglobe Japan Tokyo
68 103.58.148.186 lovedesignwedding.com host186.148.thvps.com Dot Enterprise IDC Thailand Bangkok, Bangkok
69 42.96.132.39 imclub.com.cn - - - Hangzhou Alibaba Advertising Co.,Ltd. China Hangzhou, Zhejiang
70 141.8.225.31 martymartin.com - - - Rook Media GmbH Switzerland - - -
71 5.144.133.146 posttarliocon.mihanblog.com 5-144-133-146.static.hostiran.name Noavaran Shabakeh Sabz Mehregan Company Limited Iran Mehregan, Isfahan
72 208.91.197.26 boysandgirlsclubs.org - - - Confluence Networks British Virgin Islands Road Town, Washington
73 104.17.205.73 anettesmassagefriskvardspraktik.com - - - CloudFlare United States - - -
74 64.182.121.183 downrange.tv 64-182-121-183.static.dal01.corespace.com CoreSpace United States Dallas, Texas
75 176.9.193.110 forum.goldenclone.com phpbb.goldenclone.com Hetzner Online GmbH Germany - - -
76 218.145.71.209 palbang.net no2.nayana.kr Korea Telecom - - - Suwon, Gyeonggi-do
77 210.72.91.145 klseco.ynao.ac.cn - - - China Science & Technology Network China Beijing, Beijing
78 208.91.197.25 gothamlabs.com - - - Confluence Networks British Virgin Islands Road Town, Xinjiang Uygur Zizhiqu
79 14.0.82.92 ypherb.com - - - CDNetworks - - - Seoul, Seoul
80 204.11.56.48 spacesofsilence.com ns1391.ztomy.com Confluence Networks British Virgin Islands - - -
Any information copied or otherwise reproduced from this website must have a proper attribution. If you have used any of the content displayed on TraceMyIP.org Tools, you agree to properly reference to the source of information by creating a direct link to http://tools.tracemyip.org/